PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016476085.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GeBP
Protein Properties Length: 196aa    MW: 23070.6 Da    PI: 9.649
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016476085.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573452.9e-143623697
          DUF573 36 afyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                     fy f+ +++++kv +  + +K+rrLK+K   + +k  +g++p f+++hd  ifelskk+Wg
  XP_016476085.1  3 SFYYFIAEKLQVKVDRFRMNDKVRRLKRKLFANLEK--KGQNPIFTSPHDYLIFELSKKLWG 62
                    79********************************99..9**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.8E-11262IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MYSFYYFIAE KLQVKVDRFR MNDKVRRLKR KLFANLEKKG QNPIFTSPHD YLIFELSKKL  60
WGDDYLVYEY SKKIYGGKIS GGSINRLVKN VNNVRDQVNN TFAKLKDVEK EIVVKEVAAN  120
GEIDDEDQLN FQSKYPHLAA TFNVMKKTMS LVDSDKMRDL EEELKKLQEK ETDLKIKRLD  180
LIRENCELVA EVTRGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800473.11e-141PREDICTED: uncharacterized protein LOC104246363
RefseqXP_016476085.11e-141PREDICTED: uncharacterized protein LOC107797691
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23692041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.23e-07DNA-binding storekeeper protein-related transcriptional regulator